PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 201aa    MW: 23579.4 Da    PI: 8.6339
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58672173PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-184092557
               SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                ++t++q++ Le++F +++++  +++ +L+++lg++ rq+ +W+qN+Ra++k+
  Lsa010286 40 KRLTEDQVRLLESYFDSSKKLEPDRKHQLSRQLGIPPRQIAIWYQNKRARWKN 92
               5789***********************************************95 PP

2HD-ZIP_I/II107.69e-3539129393
  HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   +rl+++qv+lLE+ F++++kLep+rK++l+r+Lg+ prq+a+W+qn+RAR+k++ lE+dy++L+ +++a + e+++L+kev+ Lr+el++
    Lsa010286  39 TKRLTEDQVRLLESYFDSSKKLEPDRKHQLSRQLGIPPRQIAIWYQNKRARWKNQSLEHDYTMLQLQLEASVLETKHLQKEVDYLRTELNK 129
                  58************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.8073393IPR001356Homeobox domain
SMARTSM003897.0E-163397IPR001356Homeobox domain
SuperFamilySSF466898.77E-1834101IPR009057Homeodomain-like
CDDcd000865.54E-143694No hitNo description
PfamPF000461.3E-154092IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-1941100IPR009057Homeodomain-like
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
TESKTRPQSP PTPHLLSIMN HSTYHNQKPN PNKPNKHTTK RLTEDQVRLL ESYFDSSKKL  60
EPDRKHQLSR QLGIPPRQIA IWYQNKRARW KNQSLEHDYT MLQLQLEASV LETKHLQKEV  120
DYLRTELNKV QSEQARHNRY YNNDYQPLMD SSFSRCGDDV GSSSKSLEDD TEHLCGFGKQ  180
VFDAAEMYTA ARMMGMDILH F
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082709.12e-40PREDICTED: homeobox-leucine zipper protein ATHB-52
TrEMBLA0A103XMD96e-75A0A103XMD9_CYNCS; Helix-turn-helix motif-containing protein
STRINGVIT_10s0003g00380.t013e-36(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.13e-30homeobox protein 52